General Information

  • ID:  hor004610
  • Uniprot ID:  P0CAX4
  • Protein name:  Augurin-B
  • Gene name:  ecrg4b
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  Augurin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007417 central nervous system development; GO:0008285 negative regulation of cell population proliferation; GO:0009611 response to wounding; GO:0031145 anaphase-promoting complex-dependent catabolic process; GO:0042127 regulation of cell population proliferation; GO:0070314 G1 to G0 transition; GO:0090398 cellular senescence
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0016324 apical plasma membrane

Sequence Information

  • Sequence:  NVWDRSRPDVQQWIQQFMYMGYDEARLETDLSYWMDQARSNDQGRQHHHDENAPMSQQDPRYNRHGANVNYDYY
  • Length:  74(71-144)
  • Propeptide:  MSLHSLCVPTILLISVLSICLSSGGSSDSKLHRILIKRDAKEIESRPKAYISVQQSKAKEFLSGLHRTKRNVWDRSRPDVQQWIQQFMYMGYDEARLETDLSYWMDQARSNDQGRQHHHDENAPMSQQDPRYNRHGANVNYDYY
  • Signal peptide:  MSLHSLCVPTILLISVLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Required for the proper formation of the central nervous system by attenuating cell proliferation during development
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0CAX4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004610_AF2.pdbhor004610_ESM.pdb

Physical Information

Mass: 1042905 Formula: C393H563N121O126S4
Absent amino acids: CK Common amino acids: DQ
pI: 4.97 Basic residues: 11
Polar residues: 21 Hydrophobic residues: 14
Hydrophobicity: -159.73 Boman Index: -27253
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 32.97
Instability Index: 6290 Extinction Coefficient cystines: 26930
Absorbance 280nm: 368.9

Literature

  • PubMed ID:  NA
  • Title:  NA